PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30068.m002588
Common NameLOC8288854, RCOM_1313650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 507aa    MW: 55321.1 Da    PI: 6.8201
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30068.m002588genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.3e-24192235144
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                    d+ep+rC+RtDGKkWRCsr+v +++k+CErH h++r rsrk++e
  30068.m002588 192 DPEPWRCKRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVE 235
                    79***************************************987 PP

2QLQ531e-18129164237
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    +FTaaQlq+L++Q  +yK+++a+ PvPpeLl +i+k
  30068.m002588 129 PFTAAQLQELERQTIIYKHMMASIPVPPELLIPITK 164
                    9********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-11128164IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-13129162IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.862129164IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.402192236IPR014977WRC domain
PfamPF088791.6E-19193235IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MGTRSGVSFV GSKKEDKAKD LEVLRMQAKE SYRVMSEDHH HHEGSTQLLP SSSSSSSSCS  60
GSFDGGGSGA GAGGPLFYSR SNRVACFGDI YDVVGASDAD AVLAGSKFSS FTFNLSGEMT  120
PSSMNMGVPF TAAQLQELER QTIIYKHMMA SIPVPPELLI PITKTQSNAS PTQFHVVKGS  180
LEMGISSCTN SDPEPWRCKR TDGKKWRCSR DVAPDQKYCE RHSHKSRPRS RKPVELHTDS  240
MASNSNNYIT NTQLLNQKPH FPSQTNSHLS NFPSAMVSAS ATAANSFNQP RGLEWFLKGE  300
TAPVPSNSDQ EWHYLKQDRI KGSDEKLYHY REGQYDSNSY MNLRDNSHSL QAHRLNENCS  360
LLLSPKSTIL NPSSQTQAQE TRHFLDAWST AMRESNAGGL DHDQCSDSSS EKILPLSTLT  420
LSMCGVSQTN EENDNGQASS TFGIMGSDKD AASVLRPHWM MNHGSWMSSP PGGPLAEALC  480
LGISNSTRAD SNLASSNGSS YDINNNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518921.10.0PREDICTED: growth-regulating factor 8 isoform X1
TrEMBLB9RYV20.0B9RYV2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s11480.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.19e-43growth-regulating factor 8